- MRPL37 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82622
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- Rabbit
- MRPL37
- This antibody was developed against Recombinant Protein corresponding to amino acids: TDGRVFHFLV FQLNTTDLDS NEGVKNLAWV DSDQLLYQHF WCLPVIKKRV VVEPVGPVGF KPETFRKFLA LYLHGA
- L2mt, L37mt, MRP-L2, MRP-L37, MRPL2, RPML2
- Human
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- mitochondrial ribosomal protein L37
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Core ESC Like Genes, Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGA
Specifications/Features
Available conjugates: Unconjugated